PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g07360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 746aa    MW: 82681 Da    PI: 5.5113
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g07360genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2050106157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 r++ +++t++q++eLe++F+ +++p+ ++r+eL++ lgL+  q+k+WFqN+R+++k+
  CA09g07360  50 RKRYHRHTQHQIQELEAYFKDCPHPDDKQRKELSRVLGLDPLQIKFWFQNKRTQMKN 106
                 789999************************************************995 PP

2START188.63.1e-592624822206
                 HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
       START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                 la+ a++e+v++a  +ep+W++s      + +n++e+ + f+++ +     +++ea+r++++v+m++ +lve+l++ +  W+  +a    +a+t++v+s
  CA09g07360 262 LALVAMEEFVQMAHMKEPLWFSSNidngtSLLNEEEYFRFFPRGIGprpigFNTEASRDTAIVIMNPINLVEILMEAN-HWSSLFAnivsRASTIDVLS 359
                 67889*********************99999************999********************************.88888888888********* PP

                 TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXH CS
       START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlph 178
                 ++      ga q+++ae+q++sp vp R+ +fvRy++   +g+w+++dvS+d+ +         R++++pSg+li++++ng skvtwvehv++++ l+h
  CA09g07360 360 TAvggnynGAMQVIFAEFQVPSPQVPtRECYFVRYCKHRADGTWAVMDVSLDQIRAGA----ALRCRRRPSGCLIQELPNGCSKVTWVEHVEVDDTLVH 454
                 ********************************************************98....5************************************ PP

                 HHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 179 wllrslvksglaegaktwvatlqrqcek 206
                 +++++lv+sgla+ga++wvatl+rqce+
  CA09g07360 455 NIYKPLVSSGLAFGAQRWVATLDRQCER 482
                 **************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-2229105IPR009057Homeodomain-like
SuperFamilySSF466894.6E-2043112IPR009057Homeodomain-like
PROSITE profilePS5007117.44347107IPR001356Homeobox domain
SMARTSM003894.4E-2148111IPR001356Homeobox domain
CDDcd000861.14E-1949108No hitNo description
PfamPF000464.7E-1850105IPR001356Homeobox domain
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PROSITE profilePS5084841.952252485IPR002913START domain
SuperFamilySSF559611.79E-32253484No hitNo description
CDDcd088754.38E-117256481No hitNo description
SMARTSM002342.0E-56261482IPR002913START domain
PfamPF018525.0E-50262482IPR002913START domain
Gene3DG3DSA:3.30.530.203.0E-6354453IPR023393START-like domain
SuperFamilySSF559614.31E-22502738No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
MIDVQVHSLD ISNNTSESDV PQDIGTKSGN SGGDADHAEQ DEDANNSRKR KRYHRHTQHQ  60
IQELEAYFKD CPHPDDKQRK ELSRVLGLDP LQIKFWFQNK RTQMKNQHER HENTHLRAEN  120
EKFKSEVMRY REALGNVSCP NCGVGQPQRV LINEMSFDER QLRLENARLR EEIVRITSEA  180
GRYVGRSLFQ NTTFQNNHNG YNSPTPADFG VLPPYSTPQS VVDGGEAFNN NNEVDIVDHQ  240
DISIMSSMIA PTEVEKQFII ELALVAMEEF VQMAHMKEPL WFSSNIDNGT SLLNEEEYFR  300
FFPRGIGPRP IGFNTEASRD TAIVIMNPIN LVEILMEANH WSSLFANIVS RASTIDVLST  360
AVGGNYNGAM QVIFAEFQVP SPQVPTRECY FVRYCKHRAD GTWAVMDVSL DQIRAGAALR  420
CRRRPSGCLI QELPNGCSKV TWVEHVEVDD TLVHNIYKPL VSSGLAFGAQ RWVATLDRQC  480
ERLASALATY SPTNSVTDMV LSTQESRRSM MKLAERMVNS FGSGVSASVG NHWTTLATGS  540
GTDENVRIMT RKSVDDPGRP PGVVLSAATS FWLPVPPKMV FDYLRDESRR TEWDILSNGG  600
TIQEMAHIAN GRETGNCVSL LKVHGQTESQ SNMLILQECS TDLTGSFVIY APIDINSMNV  660
VLNGGDPDFV ALLPSGFAIL PDGPPAGNCR GAYNDGSGGS LLTVAFQILV NSVPTARLSL  720
GSVATVNNLI SCTVDRIKGS LFPEA*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016580642.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLM1DTG60.0M1DTG6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000941240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2